Lineage for d1mk9f1 (1mk9 F:209-308)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352841Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 352855Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 352856Family a.11.2.1: Second domain of FERM [47032] (6 proteins)
  6. 352882Protein Talin [81716] (1 species)
  7. 352883Species Chicken (Gallus gallus) [TaxId:9031] [81717] (4 PDB entries)
  8. 352890Domain d1mk9f1: 1mk9 F:209-308 [79227]
    Other proteins in same PDB: d1mk9b2, d1mk9d2, d1mk9f2, d1mk9h2

Details for d1mk9f1

PDB Entry: 1mk9 (more details), 2.8 Å

PDB Description: crystal structure of an integrin beta3-talin chimera

SCOP Domain Sequences for d1mk9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mk9f1 a.11.2.1 (F:209-308) Talin {Chicken (Gallus gallus)}
pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
eyikqkgerkifmahkncgnmseieakvryvklarslkty

SCOP Domain Coordinates for d1mk9f1:

Click to download the PDB-style file with coordinates for d1mk9f1.
(The format of our PDB-style files is described here.)

Timeline for d1mk9f1: