SCOP 1.69: Domain d1mk9d2: 1mk9 D:309-400

Lineage for d1mk9d2 (1mk9 D:309-400)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)
Fold b.55: PH domain-like [50728] (1 superfamily)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
Superfamily b.55.1: PH domain-like [50729] (9 families)
Family b.55.1.5: Third domain of FERM [50776] (6 proteins)
Protein Talin [82144] (1 species)
Species Chicken (Gallus gallus) [TaxId:9031] [82145] (4 PDB entries)
Domain d1mk9d2: 1mk9 D:309-400 [79226]
Other proteins in same PDB: d1mk9b1, d1mk9d1, d1mk9f1, d1mk9h1

Details for d1mk9d2

PDB Entry: 1mk9 (more details), 2.8 Å

PDB Description: crystal structure of an integrin beta3-talin chimera

SCOP Domain Sequences for d1mk9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mk9d2 b.55.1.5 (D:309-400) Talin {Chicken (Gallus gallus)}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidiil

SCOP Domain Coordinates for d1mk9d2:

Click to download the PDB-style file with coordinates for d1mk9d2.
(The format of our PDB-style files is described here.)

Timeline for d1mk9d2: