SCOPe 2.08: Domain d1mk9d1: 1mk9 D:209-308

Lineage for d1mk9d1 (1mk9 D:209-308)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
core: 3 helices; bundle, closed, left-handed twist; up-and-down
Superfamily a.11.2: Second domain of FERM [47031] (2 families)
automatically mapped to Pfam PF00373
Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
Protein Talin [81716] (2 species)
Species Chicken (Gallus gallus) [TaxId:9031] [81717] (5 PDB entries)
Domain d1mk9d1: 1mk9 D:209-308 [79225]
Other proteins in same PDB: d1mk9b2, d1mk9d2, d1mk9f2, d1mk9h2
chimera with an integrin beta3 peptide, chains A, C, E and G

Details for d1mk9d1

PDB Entry: 1mk9 (more details), 2.8 Å

PDB Description: crystal structure of an integrin beta3-talin chimera

PDB Compounds: (D:) Talin

SCOPe Domain Sequences for d1mk9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mk9d1 a.11.2.1 (D:209-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]}
pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
eyikqkgerkifmahkncgnmseieakvryvklarslkty

SCOPe Domain Coordinates for d1mk9d1:

Click to download the PDB-style file with coordinates for d1mk9d1.
(The format of our PDB-style files is described here.)

Timeline for d1mk9d1: