Lineage for d1mk9b2 (1mk9 B:309-398)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378166Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 378167Superfamily b.55.1: PH domain-like [50729] (8 families) (S)
  5. 378331Family b.55.1.5: Third domain of FERM [50776] (6 proteins)
  6. 378357Protein Talin [82144] (1 species)
  7. 378358Species Chicken (Gallus gallus) [TaxId:9031] [82145] (4 PDB entries)
  8. 378363Domain d1mk9b2: 1mk9 B:309-398 [79224]
    Other proteins in same PDB: d1mk9b1, d1mk9d1, d1mk9f1, d1mk9h1

Details for d1mk9b2

PDB Entry: 1mk9 (more details), 2.8 Å

PDB Description: crystal structure of an integrin beta3-talin chimera

SCOP Domain Sequences for d1mk9b2:

Sequence, based on SEQRES records: (download)

>d1mk9b2 b.55.1.5 (B:309-398) Talin {Chicken (Gallus gallus)}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidi

Sequence, based on observed residues (ATOM records): (download)

>d1mk9b2 b.55.1.5 (B:309-398) Talin {Chicken (Gallus gallus)}
gvsfflvkekmkglvprllgitkecvmrvdektkeviqewsltnikrwaaspksftldfg
dyqdgyysvqttegeqiaqliagyidi

SCOP Domain Coordinates for d1mk9b2:

Click to download the PDB-style file with coordinates for d1mk9b2.
(The format of our PDB-style files is described here.)

Timeline for d1mk9b2: