Lineage for d1mk7d1 (1mk7 D:209-308)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 211415Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 211428Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 211429Family a.11.2.1: Second domain of FERM [47032] (6 proteins)
  6. 211454Protein Talin [81716] (1 species)
  7. 211455Species Chicken (Gallus gallus) [TaxId:9031] [81717] (4 PDB entries)
  8. 211459Domain d1mk7d1: 1mk7 D:209-308 [79221]
    Other proteins in same PDB: d1mk7b2, d1mk7d2
    chimera with an integrin beta3 peptide, chains A and C

Details for d1mk7d1

PDB Entry: 1mk7 (more details), 2.2 Å

PDB Description: crystal structure of an integrin beta3-talin chimera

SCOP Domain Sequences for d1mk7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mk7d1 a.11.2.1 (D:209-308) Talin {Chicken (Gallus gallus)}
pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk
eyikqkgerkifmahkncgnmseieakvryvklarslkty

SCOP Domain Coordinates for d1mk7d1:

Click to download the PDB-style file with coordinates for d1mk7d1.
(The format of our PDB-style files is described here.)

Timeline for d1mk7d1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mk7d2