![]() | Class a: All alpha proteins [46456] (171 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.2: Second domain of FERM [47031] (1 family) ![]() |
![]() | Family a.11.2.1: Second domain of FERM [47032] (6 proteins) |
![]() | Protein Talin [81716] (1 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [81717] (4 PDB entries) |
![]() | Domain d1mk7d1: 1mk7 D:209-308 [79221] Other proteins in same PDB: d1mk7b2, d1mk7d2 chimera with an integrin beta3 peptide, chains A and C |
PDB Entry: 1mk7 (more details), 2.2 Å
SCOP Domain Sequences for d1mk7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mk7d1 a.11.2.1 (D:209-308) Talin {Chicken (Gallus gallus)} pvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgflelkdflpk eyikqkgerkifmahkncgnmseieakvryvklarslkty
Timeline for d1mk7d1: