SCOPe 2.04: Domain d1mk2b_: 1mk2 B:

Lineage for d1mk2b_ (1mk2 B:)

1. Root: SCOPe 2.04

2. Class j: Peptides [58231] (126 folds)

3. Fold j.64: Smad-binding domain of Sara [58717] (1 superfamily)

4. Superfamily j.64.1: Smad-binding domain of Sara [58718] (1 family)

5. Family j.64.1.1: Smad-binding domain of Sara [58719] (1 protein)

6. Protein Smad-binding domain of Sara [58720] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [58721] (2 PDB entries)

8. Domain d1mk2b_: 1mk2 B: [79218]
   Other proteins in same PDB: d1mk2a_
   bound to the Smad3 MH2 domain
   complexed with acy

Details for d1mk2b_

PDB Entry: 1mk2, 2.74 Å

PDB Description: SMAD3 SBD complex

PDB Compounds: (B:) Madh-interacting protein

SCOPe Domain Sequences for d1mk2b_:

Sequence; same for both SEQRES and ATOM records:

>d1mk2b_ j.64.1.1 (B:) Smad-binding domain of Sara {Human (Homo sapiens) [TaxId: 9606]}
spnpnnpaeycstipplqqaqasgalssppptvmvpvg

Timeline for d1mk2b_:

• d1mk2b_ first appeared in SCOP 1.63
  
• d1mk2b_ appears in SCOPe 2.03
  
• d1mk2b_ appears in SCOPe 2.05
  
• d1mk2b_ appears in the current release, SCOPe 2.08