Lineage for d1mk2b_ (1mk2 B:)

  1. Root: SCOP 1.63
  2. 274027Class j: Peptides [58231] (101 folds)
  3. 275011Fold j.64: Smad-binding domain of Sara [58717] (1 superfamily)
  4. 275012Superfamily j.64.1: Smad-binding domain of Sara [58718] (1 family) (S)
  5. 275013Family j.64.1.1: Smad-binding domain of Sara [58719] (1 protein)
  6. 275014Protein Smad-binding domain of Sara [58720] (1 species)
  7. 275015Species Human (Homo sapiens) [TaxId:9606] [58721] (2 PDB entries)
  8. 275018Domain d1mk2b_: 1mk2 B: [79218]
    Other proteins in same PDB: d1mk2a_
    bound to the Smad3 MH2 domain
    complexed with acy

Details for d1mk2b_

PDB Entry: 1mk2 (more details), 2.74 Å

PDB Description: SMAD3 SBD complex

SCOP Domain Sequences for d1mk2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mk2b_ j.64.1.1 (B:) Smad-binding domain of Sara {Human (Homo sapiens)}
spnpnnpaeycstipplqqaqasgalssppptvmvpvg

SCOP Domain Coordinates for d1mk2b_:

Click to download the PDB-style file with coordinates for d1mk2b_.
(The format of our PDB-style files is described here.)

Timeline for d1mk2b_:

275018
d1mk2b_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1mk2a_