Lineage for d1mk2a_ (1mk2 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1306941Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 1306942Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 1306943Family b.26.1.1: SMAD domain [49880] (4 proteins)
  6. 1306957Protein Smad3 MH2 domain [82030] (1 species)
  7. 1306958Species Human (Homo sapiens) [TaxId:9606] [82031] (3 PDB entries)
    Uniprot P84022 228-425
  8. 1306962Domain d1mk2a_: 1mk2 A: [79217]
    Other proteins in same PDB: d1mk2b_
    complexed with acy

Details for d1mk2a_

PDB Entry: 1mk2 (more details), 2.74 Å

PDB Description: SMAD3 SBD complex
PDB Compounds: (A:) smad 3

SCOPe Domain Sequences for d1mk2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mk2a_ b.26.1.1 (A:) Smad3 MH2 domain {Human (Homo sapiens) [TaxId: 9606]}
dlqpvtycepafwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnr
naaveltrrhigrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcn
lkifnnqefaallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielh
lngplqwldkvltqmgs

SCOPe Domain Coordinates for d1mk2a_:

Click to download the PDB-style file with coordinates for d1mk2a_.
(The format of our PDB-style files is described here.)

Timeline for d1mk2a_: