SCOPe 2.07: Domain d1mjvb1: 1mjv B:14-108

Lineage for d1mjvb1 (1mjv B:14-108)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.1: Platelet-derived growth factor-like [57502] (4 proteins)

6. Protein Vascular endothelial growth factor, VEGF [57505] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57506] (22 PDB entries)
   Uniprot P15692 40-133

8. Domain d1mjvb1: 1mjv B:14-108 [79215]
   Other proteins in same PDB: d1mjva2, d1mjvb2
   disulfide deficient mutant
   mutant

Details for d1mjvb1

PDB Entry: 1mjv, 2.1 Å

PDB Description: disulfide deficient mutant of vascular endothelial growth factor a (c51a and c60a)

PDB Compounds: (B:) Vascular Endothelial Growth Factor A

SCOPe Domain Sequences for d1mjvb1:

Sequence; same for both SEQRES and ATOM records:

>d1mjvb1 g.17.1.1 (B:14-108) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
vvkfmdvyqrsychpietlvdifqeypdeieyifkpsavplmrcggacndeglecvptee
snitmqimrikphqgqhigemsflqhnkcecrpkk

Timeline for d1mjvb1:

• d1mjvb1 first appeared in SCOP 1.63, called d1mjvb_
  
• d1mjvb1 appears in SCOPe 2.06
  
• d1mjvb1 appears in the current release, SCOPe 2.08