Lineage for d1mjva_ (1mjv A:)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749103Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 749104Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) (S)
  5. 749105Family g.17.1.1: Platelet-derived growth factor-like [57502] (3 proteins)
  6. 749117Protein Vascular endothelial growth factor, VEGF [57505] (3 species)
  7. 749120Species Human (Homo sapiens) [TaxId:9606] [57506] (15 PDB entries)
  8. 749156Domain d1mjva_: 1mjv A: [79214]

Details for d1mjva_

PDB Entry: 1mjv (more details), 2.1 Å

PDB Description: disulfide deficient mutant of vascular endothelial growth factor a (c51a and c60a)
PDB Compounds: (A:) Vascular Endothelial Growth Factor A

SCOP Domain Sequences for d1mjva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjva_ g.17.1.1 (A:) Vascular endothelial growth factor, VEGF {Human (Homo sapiens) [TaxId: 9606]}
mvvkfmdvyqrsychpietlvdifqeypdeieyifkpsavplmrcggacndeglecvpte
esnitmqimrikphqgqhigemsflqhnkcecrpkk

SCOP Domain Coordinates for d1mjva_:

Click to download the PDB-style file with coordinates for d1mjva_.
(The format of our PDB-style files is described here.)

Timeline for d1mjva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mjvb_