Lineage for d1mjta_ (1mjt A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 337215Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 337216Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
  5. 337217Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (1 protein)
  6. 337218Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 337364Species Staphylococcus aureus [TaxId:1280] [82823] (1 PDB entry)
  8. 337365Domain d1mjta_: 1mjt A: [79212]

Details for d1mjta_

PDB Entry: 1mjt (more details), 2.4 Å

PDB Description: crystal structure of sanos, a bacterial nitric oxide synthase oxygenase protein, in complex with nad+ and seitu

SCOP Domain Sequences for d1mjta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjta_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Staphylococcus aureus}
hlfkeaqafienmykechyetqiinkrlhdieleiketgtythteeeliygakmawrnsn
rcigrlfwdslnvidardvtdeasflssityhitqatnegklkpyitiyapkdgpkifnn
qliryagydncgdpaekevtrlanhlgwkgkgtnfdvlpliyqlpnesvkfyeyptslik
evpiehnhypklrklnlkwyavpiisnmdlkiggivyptapfngwymvteigvrnfiddy
rynllekvadafefdtlknnsfnkdralvelnyavyhsfkkegvsivdhltaakqfelfe
rneaqqgrqvtgkwswlapplsptltsnyhhgydntvkdpnffykk

SCOP Domain Coordinates for d1mjta_:

Click to download the PDB-style file with coordinates for d1mjta_.
(The format of our PDB-style files is described here.)

Timeline for d1mjta_: