Lineage for d1mjsa_ (1mjs A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372848Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2372849Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2372850Family b.26.1.1: SMAD domain [49880] (5 protein domains)
  6. 2372864Protein Smad3 MH2 domain [82030] (1 species)
  7. 2372865Species Human (Homo sapiens) [TaxId:9606] [82031] (4 PDB entries)
    Uniprot P84022 228-425
  8. 2372866Domain d1mjsa_: 1mjs A: [79211]

Details for d1mjsa_

PDB Entry: 1mjs (more details), 1.91 Å

PDB Description: MH2 domain of transcriptional factor SMAD3
PDB Compounds: (A:) smad 3

SCOPe Domain Sequences for d1mjsa_:

Sequence, based on SEQRES records: (download)

>d1mjsa_ b.26.1.1 (A:) Smad3 MH2 domain {Human (Homo sapiens) [TaxId: 9606]}
pafwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnrnaaveltrr
higrgvrlyyiggevfaeclsdsaifvqspncnqrygwhpatvckippgcnlkifnnqef
aallaqsvnqgfeavyqltrmctirmsfvkgwgaeyrrqtvtstpcwielhlngplqwld
kvltqmgsps

Sequence, based on observed residues (ATOM records): (download)

>d1mjsa_ b.26.1.1 (A:) Smad3 MH2 domain {Human (Homo sapiens) [TaxId: 9606]}
pafwcsisyyelnqrvgetfhasqpsmtvdgftdpsnserfclgllsnvnrnaaveltrr
higrgvrlyyiggevfaeclsdsaifvqspncnqratvckippgcnlkifnnqefaalla
qsvnqgfeavyqltrmctirmsfvkgwtvtstpcwielhlngplqwldkvltqmgsps

SCOPe Domain Coordinates for d1mjsa_:

Click to download the PDB-style file with coordinates for d1mjsa_.
(The format of our PDB-style files is described here.)

Timeline for d1mjsa_: