Lineage for d1mjib_ (1mji B:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 727201Fold d.77: Ribosomal protein L5 [55281] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654
  4. 727202Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) (S)
  5. 727203Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein)
  6. 727204Protein Ribosomal protein L5 [55284] (3 species)
    synonym: 50S ribosomal protein L5p, HMAL5, HL13
  7. 727249Species Thermus thermophilus [TaxId:274] [82718] (1 PDB entry)
  8. 727251Domain d1mjib_: 1mji B: [79209]
    complex with a 5S rRNA fragment
    complexed with k, mg, mse

Details for d1mjib_

PDB Entry: 1mji (more details), 2.5 Å

PDB Description: detailed analysis of rna-protein interactions within the bacterial ribosomal protein l5/5s rrna complex
PDB Compounds: (B:) 50S ribosomal protein L5

SCOP Domain Sequences for d1mjib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjib_ d.77.1.1 (B:) Ribosomal protein L5 {Thermus thermophilus [TaxId: 274]}
dvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelali
tgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnpn
sfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk

SCOP Domain Coordinates for d1mjib_:

Click to download the PDB-style file with coordinates for d1mjib_.
(The format of our PDB-style files is described here.)

Timeline for d1mjib_: