| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.77: Ribosomal protein L5 [55281] (1 superfamily) beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654 |
Superfamily d.77.1: Ribosomal protein L5 [55282] (1 family) ![]() |
| Family d.77.1.1: Ribosomal protein L5 [55283] (1 protein) |
| Protein Ribosomal protein L5 [55284] (3 species) synonym: 50S ribosomal protein L5p, HMAL5, HL13 |
| Species Thermus thermophilus [TaxId:274] [82718] (1 PDB entry) |
| Domain d1mjib_: 1mji B: [79209] complex with a 5S rRNA fragment complexed with k, mg, mse |
PDB Entry: 1mji (more details), 2.5 Å
SCOP Domain Sequences for d1mjib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mjib_ d.77.1.1 (B:) Ribosomal protein L5 {Thermus thermophilus [TaxId: 274]}
dvalkrkyyeevrpelirrfgyqnvwevprlekvvinqglgeakedarilekaaqelali
tgqkpavtrakksisnfklrkgmpiglrvtlrrdrmwiflekllnvalprirdfrglnpn
sfdgrgnynlglreqlifpeitydmvdalrgmdiavvttaetdeearallellgfpfrk
Timeline for d1mjib_: