Lineage for d1mjfb_ (1mjf B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129722Family c.66.1.17: Spermidine synthase [69557] (3 protein domains)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 2129723Protein Putative spermidine synthetase PF0127 (SpeE) [82479] (1 species)
  7. 2129724Species Pyrococcus furiosus [TaxId:2261] [82480] (1 PDB entry)
  8. 2129726Domain d1mjfb_: 1mjf B: [79199]
    structural genomics

Details for d1mjfb_

PDB Entry: 1mjf (more details), 1.8 Å

PDB Description: putative spermidine synthetase from pyrococcus furiosus pfu-132382
PDB Compounds: (B:) spermidine synthase

SCOPe Domain Sequences for d1mjfb_:

Sequence, based on SEQRES records: (download)

>d1mjfb_ c.66.1.17 (B:) Putative spermidine synthetase PF0127 (SpeE) {Pyrococcus furiosus [TaxId: 2261]}
afiewyprgygvafkikkkiyeklskyqkievyetegfgrllaldgtvqlvtlgersyhe
plvhpamlahpkpkrvlvigggdggtvrevlqhdvdevimveidedvimvskdlikidng
lleamlngkhekakltigdgfefiknnrgfdviiadstdpvgpakvlfseefyryvydal
nnpgiyvtqagsvylftdelisaykemkkvfdrvyyysfpvigyaspwaflvgvkgdidf
tkidrerakklqleyydplmhetlfqmpkyiretlq

Sequence, based on observed residues (ATOM records): (download)

>d1mjfb_ c.66.1.17 (B:) Putative spermidine synthetase PF0127 (SpeE) {Pyrococcus furiosus [TaxId: 2261]}
afiewyprgygvafkikkkiyeklskyqkievyetegfgrllaldgtvqlvtlgersyhe
plvhpamlahpkpkrvlvigggdggtvrevlqhdvdevimveidedvimvskdlikidng
lleamlngkhekakltigdgfefnnrgfdviiadstdpvlfseefyryvydalnnpgiyv
tqagsvylftdelisaykemkkvfdrvyyysfpvigyaspwaflvgvkgdidftkidrer
akklqleyydplmhetlfqmpkyiretlq

SCOPe Domain Coordinates for d1mjfb_:

Click to download the PDB-style file with coordinates for d1mjfb_.
(The format of our PDB-style files is described here.)

Timeline for d1mjfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mjfa_