Class b: All beta proteins [48724] (144 folds) |
Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) |
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (10 proteins) barrel, closed; n=5, S=10 |
Protein OB-fold domains of BRCA2 [82099] (2 species) duplication: tandem repeat of three OB-fold domains |
Species Mouse (Mus musculus) [TaxId:10090] [82100] (2 PDB entries) |
Domain d1mjea5: 1mje A:2971-3110 [79197] Other proteins in same PDB: d1mjea1, d1mjea2 complex with ssDNA |
PDB Entry: 1mje (more details), 3.5 Å
SCOP Domain Sequences for d1mjea5:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mjea5 b.40.4.3 (A:2971-3110) OB-fold domains of BRCA2 {Mouse (Mus musculus)} reslhfsrlsdpafqppcsevdvvgvvvsvvkpiglaplvylsdeclnllvvkfgidlne dikprvliaasnlqcqpestsgvptlfachfsifsaspkeayfqekvnnlkhaienidtf ykeaekklihvlegdspkw
Timeline for d1mjea5:
View in 3D Domains from same chain: (mouse over for more information) d1mjea1, d1mjea2, d1mjea3, d1mjea4 |