Lineage for d1mjea1 (1mje A:2399-2589)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018146Fold a.170: BRCA2 helical domain [81871] (1 superfamily)
    multihelical; contains a 3-helical bundle surrounded by several shorter helices
  4. 2018147Superfamily a.170.1: BRCA2 helical domain [81872] (1 family) (S)
    automatically mapped to Pfam PF09169
  5. 2018148Family a.170.1.1: BRCA2 helical domain [81873] (1 protein)
  6. 2018149Protein BRCA2 helical domain [81874] (2 species)
  7. 2018150Species Mouse (Mus musculus) [TaxId:10090] [81875] (2 PDB entries)
  8. 2018152Domain d1mjea1: 1mje A:2399-2589 [79193]
    Other proteins in same PDB: d1mjea2, d1mjea3, d1mjea4, d1mjea5
    complexed with human Dss1 fragment, chain B
    protein/DNA complex

Details for d1mjea1

PDB Entry: 1mje (more details), 3.5 Å

PDB Description: structure of a brca2-dss1-ssdna complex
PDB Compounds: (A:) breast cancer 2

SCOPe Domain Sequences for d1mjea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjea1 a.170.1.1 (A:2399-2589) BRCA2 helical domain {Mouse (Mus musculus) [TaxId: 10090]}
kdlmsslqsardlqdmriknkerrhlrlqpgslyltksstlprislqaavgdrapsacsp
kqlyiygvskecinvnsknaeyfqfdiqdhfgkedlcagkgfqladggwlipsndgkagk
eefyralcdtpgvdpklissiwvanhyrwivwklaamefafpkefanrclnpervllqlk
yrydveidnsr

SCOPe Domain Coordinates for d1mjea1:

Click to download the PDB-style file with coordinates for d1mjea1.
(The format of our PDB-style files is described here.)

Timeline for d1mjea1: