Lineage for d1mj4a_ (1mj4 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973074Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2973075Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2973076Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 2973141Protein Sulfite oxidase, N-terminal domain [55866] (2 species)
  7. 2973145Species Human (Homo sapiens) [TaxId:9606] [82777] (1 PDB entry)
  8. 2973146Domain d1mj4a_: 1mj4 A: [79189]
    complexed with gol, hem, so4

Details for d1mj4a_

PDB Entry: 1mj4 (more details), 1.2 Å

PDB Description: Crystal Structure Analysis of the cytochrome b5 domain of human sulfite oxidase
PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d1mj4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sthiytkeevsshtspetgiwvtlgsevfdvtefvdlhpggpsklmlaaggplepfwaly
avhnqshvrellaqykigel

SCOPe Domain Coordinates for d1mj4a_:

Click to download the PDB-style file with coordinates for d1mj4a_.
(The format of our PDB-style files is described here.)

Timeline for d1mj4a_: