Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) |
Family d.120.1.1: Cytochrome b5 [55857] (5 proteins) |
Protein Sulfite oxidase, N-terminal domain [55866] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [82777] (1 PDB entry) |
Domain d1mj4a_: 1mj4 A: [79189] complexed with gol, hem, so4 |
PDB Entry: 1mj4 (more details), 1.2 Å
SCOPe Domain Sequences for d1mj4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} sthiytkeevsshtspetgiwvtlgsevfdvtefvdlhpggpsklmlaaggplepfwaly avhnqshvrellaqykigel
Timeline for d1mj4a_: