Lineage for d1mj3c_ (1mj3 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099550Family c.14.1.3: Crotonase-like [52103] (14 protein domains)
  6. 2099644Protein Enoyl-CoA hydratase (crotonase) [52106] (2 species)
  7. 2099645Species Norway rat (Rattus norvegicus) [TaxId:10116] [52107] (4 PDB entries)
  8. 2099648Domain d1mj3c_: 1mj3 C: [79185]
    complexed with hxc

Details for d1mj3c_

PDB Entry: 1mj3 (more details), 2.1 Å

PDB Description: Crystal Structure Analysis of rat enoyl-CoA hydratase in complex with hexadienoyl-CoA
PDB Compounds: (C:) enoyl-coa hydratase, mitochondrial

SCOPe Domain Sequences for d1mj3c_:

Sequence, based on SEQRES records: (download)

>d1mj3c_ c.14.1.3 (C:) Enoyl-CoA hydratase (crotonase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
ekafaagadikemqnrtfqdcysgkflshwdhitrikkpviaavngyalgggcelammcd
iiyagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvs
kifpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatd
drregmsafvekrkanfkdh

Sequence, based on observed residues (ATOM records): (download)

>d1mj3c_ c.14.1.3 (C:) Enoyl-CoA hydratase (crotonase) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
anfqyiitekkgknssvgliqlnrpkalnalcnglieelnqaletfeedpavgaivltgg
ekafaagadikemqnrtfqdcysglshwdhitrikkpviaavngyalgggcelammcdii
yagekaqfgqpeillgtipgaggtqrltravgkslamemvltgdrisaqdakqaglvski
fpvetlveeaiqcaekiannskiivamakesvnaafemtltegnklekklfystfatddr
regmsafvekrkanfkdh

SCOPe Domain Coordinates for d1mj3c_:

Click to download the PDB-style file with coordinates for d1mj3c_.
(The format of our PDB-style files is described here.)

Timeline for d1mj3c_: