SCOP 1.67: Domain d1mj1p_: 1mj1 P:

Lineage for d1mj1p_ (1mj1 P:)

1. Root: SCOP 1.67

2. Class i: Low resolution protein structures [58117] (22 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.1: Ribosome complexes [58120] (1 protein)

6. Protein 70S ribosome functional complex [58121] (2 species)

7. Species Escherichia coli [TaxId:562] [58123] (27 PDB entries)

8. Domain d1mj1p_: 1mj1 P: [79180]

Details for d1mj1p_

PDB Entry: 1mj1

PDB Description: fitting the ternary complex of ef-tu/trna/gtp and ribosomal proteins into a 13 a cryo-em map of the coli 70s ribosome

SCOP Domain Sequences for d1mj1p_:

Sequence; same for both SEQRES and ATOM records:

>d1mj1p_ i.1.1.1 (P:) 70S ribosome functional complex {Escherichia coli}
ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
kaprk

Timeline for d1mj1p_:

• d1mj1p_ first appeared in SCOP 1.63
  
• d1mj1p_ appears in SCOP 1.65
  
• d1mj1p_ appears in SCOP 1.69
  
• d1mj1p_ appears in the current release, SCOPe 2.08