Lineage for d1mj1a_ (1mj1 A:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3042559Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 3042930Domain d1mj1a_: 1mj1 A: [79175]
    Fitting the ternary complex of EF-TU/tRNA/GTP in the cryo-EM map
    protein/RNA complex

Details for d1mj1a_

PDB Entry: 1mj1 (more details)

PDB Description: fitting the ternary complex of ef-tu/trna/gtp and ribosomal proteins into a 13 a cryo-em map of the coli 70s ribosome
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d1mj1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mj1a_ i.1.1.1 (A:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
akgefirtkrhvnvgtighvdhgkttltaaltyvaaaenrnvevkdygdidkareerarg
itintahveyetakrhyshvdcrghadyiknmitgaaqmdgailvvsaadgrmrqtrehi
llarqvgvryivvfmnkvdmvddrelldlvemevrdllnqyefrgdevrvirgsallale
emhknrktkrgenewvdkiwelldaideyirtrvrdvdkrflmrvedvftitgrgtvatg
riergkvkvgdeveivglaretrktvvtgvemhrktlqegiagdnvglllrgvsreever
gqvlakrgsitrhtkfeasvyilkkeeggrhtgfftgyrrqfyfrttdvtgvvrlrqgve
mvmrgdnvtftvelikrvaleeglrfaireggrtvgagvvtkile

SCOPe Domain Coordinates for d1mj1a_:

Click to download the PDB-style file with coordinates for d1mj1a_.
(The format of our PDB-style files is described here.)

Timeline for d1mj1a_: