Lineage for d1mizb2 (1miz B:309-400)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 378166Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 378167Superfamily b.55.1: PH domain-like [50729] (8 families) (S)
  5. 378331Family b.55.1.5: Third domain of FERM [50776] (6 proteins)
  6. 378357Protein Talin [82144] (1 species)
  7. 378358Species Chicken (Gallus gallus) [TaxId:9031] [82145] (4 PDB entries)
  8. 378360Domain d1mizb2: 1miz B:309-400 [79173]
    Other proteins in same PDB: d1mizb1

Details for d1mizb2

PDB Entry: 1miz (more details), 1.9 Å

PDB Description: Crystal structure of an integrin beta3-talin chimera

SCOP Domain Sequences for d1mizb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mizb2 b.55.1.5 (B:309-400) Talin {Chicken (Gallus gallus)}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidiil

SCOP Domain Coordinates for d1mizb2:

Click to download the PDB-style file with coordinates for d1mizb2.
(The format of our PDB-style files is described here.)

Timeline for d1mizb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mizb1