Lineage for d1mizb2 (1miz B:309-400)
- Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds) 
Fold b.55: PH domain-like [50728] (1 superfamily)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helixSuperfamily b.55.1: PH domain-like [50729] (6 families) 
Family b.55.1.5: Third domain of FERM [50776] (6 proteins) Protein Talin [82144] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [82145] (4 PDB entries) 
Domain d1mizb2: 1miz B:309-400 [79173]
Other proteins in same PDB: d1mizb1
Details for d1mizb2
PDB Entry: 1miz (more details), 1.9 Å
PDB Description: Crystal structure of an integrin beta3-talin chimera
SCOP Domain Sequences for d1mizb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mizb2 b.55.1.5 (B:309-400) Talin {Chicken (Gallus gallus)}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidiil
SCOP Domain Coordinates for d1mizb2:
Click to download the PDB-style file with coordinates for d1mizb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mizb2:
- d1mizb2 first appeared in SCOP 1.63
- d1mizb2 appears in SCOP 1.67
- d1mizb2 appears in the current release, SCOPe 2.08
View in 3D
