Lineage for d1mizb1 (1miz B:200-308)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352841Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 352855Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 352856Family a.11.2.1: Second domain of FERM [47032] (6 proteins)
  6. 352882Protein Talin [81716] (1 species)
  7. 352883Species Chicken (Gallus gallus) [TaxId:9031] [81717] (4 PDB entries)
  8. 352885Domain d1mizb1: 1miz B:200-308 [79172]
    Other proteins in same PDB: d1mizb2
    chimera with an integrin beta3 peptide, chain A

Details for d1mizb1

PDB Entry: 1miz (more details), 1.9 Å

PDB Description: Crystal structure of an integrin beta3-talin chimera

SCOP Domain Sequences for d1mizb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mizb1 a.11.2.1 (B:200-308) Talin {Chicken (Gallus gallus)}
sdqnvdsrdpvqlnllyvqarddilngshpvsfdkacefagyqcqiqfgphneqkhkpgf
lelkdflpkeyikqkgerkifmahkncgnmseieakvryvklarslkty

SCOP Domain Coordinates for d1mizb1:

Click to download the PDB-style file with coordinates for d1mizb1.
(The format of our PDB-style files is described here.)

Timeline for d1mizb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mizb2