SCOP 1.71: Domain d1miya1: 1miy A:140-404

Lineage for d1miya1 (1miy A:140-404)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.173: Poly A polymerase C-terminal region-like [81890] (1 superfamily)
   multihelical; can be divided into three subdomains (neck, body and tail)

4. Superfamily a.173.1: Poly A polymerase C-terminal region-like [81891] (1 family)
   the neck subdomain is an alpha-alpha superhelix; the tail subdomain is similar to the RuvA C-terminal domain-like

5. Family a.173.1.1: Poly A polymerase C-terminal region-like [81892] (2 proteins)
   the 'neck' domain corresponds to the C-terminal part of Pfam 01743

6. Protein tRNA CCA-adding enzyme, C-terminal domains [81893] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [81894] (3 PDB entries)

8. Domain d1miya1: 1miy A:140-404 [79168]
   Other proteins in same PDB: d1miya2, d1miyb2

Details for d1miya1

PDB Entry: 1miy, 3.52 Å

PDB Description: Crystal structure of Bacillus stearothermophilus CCA-adding enzyme in complex with CTP

SCOP Domain Sequences for d1miya1:

Sequence; same for both SEQRES and ATOM records:

>d1miya1 a.173.1.1 (A:140-404) tRNA CCA-adding enzyme, C-terminal domains {Bacillus stearothermophilus}
iirtvgeaekrfredalrmmravrfvselgfalapdteqaivqnapllahisvermtmem
ekllggpfaaralpllaetglnaylpglagkekqlrlaaayrwpwlaareerwallchal
gvqesrpflrawklpnkvvdeagailtaladiprpeawtneqlfsagleralsvetvraa
ftgappgpwheklrrrfaslpiktkgelavngkdviewvgkpagpwvkealdaiwravvn
gevenekeriyawlmernrtreknc

Timeline for d1miya1:

• d1miya1 first appeared in SCOP 1.63
  
• d1miya1 appears in SCOP 1.69
  
• d1miya1 appears in SCOP 1.73
  
• d1miya1 appears in the current release, SCOPe 2.08