Lineage for d1mixa2 (1mix A:309-400)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300574Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 300575Superfamily b.55.1: PH domain-like [50729] (6 families) (S)
  5. 300719Family b.55.1.5: Third domain of FERM [50776] (6 proteins)
  6. 300745Protein Talin [82144] (1 species)
  7. 300746Species Chicken (Gallus gallus) [TaxId:9031] [82145] (4 PDB entries)
  8. 300747Domain d1mixa2: 1mix A:309-400 [79167]
    Other proteins in same PDB: d1mixa1

Details for d1mixa2

PDB Entry: 1mix (more details), 1.75 Å

PDB Description: Crystal structure of a FERM domain of Talin

SCOP Domain Sequences for d1mixa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus)}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidiil

SCOP Domain Coordinates for d1mixa2:

Click to download the PDB-style file with coordinates for d1mixa2.
(The format of our PDB-style files is described here.)

Timeline for d1mixa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mixa1