Lineage for d1mixa2 (1mix A:309-400)
- Root: SCOP 1.63
Class b: All beta proteins [48724] (119 folds) 
Fold b.55: PH domain-like [50728] (1 superfamily)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helixSuperfamily b.55.1: PH domain-like [50729] (6 families) 
Family b.55.1.5: Third domain of FERM [50776] (6 proteins) Protein Talin [82144] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [82145] (4 PDB entries) 
Domain d1mixa2: 1mix A:309-400 [79167]
Other proteins in same PDB: d1mixa1
Details for d1mixa2
PDB Entry: 1mix (more details), 1.75 Å
PDB Description: Crystal structure of a FERM domain of Talin
SCOP Domain Sequences for d1mixa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus)}
gvsfflvkekmkgknklvprllgitkecvmrvdektkeviqewsltnikrwaaspksftl
dfgdyqdgyysvqttegeqiaqliagyidiil
SCOP Domain Coordinates for d1mixa2:
Click to download the PDB-style file with coordinates for d1mixa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mixa2:
- d1mixa2 is new in SCOP 1.63
- d1mixa2 appears in SCOP 1.65
- d1mixa2 appears in the current release, SCOPe 2.08
View in 3D
