SCOP 1.73: Domain d1miqa_: 1miq A:

Lineage for d1miqa_ (1miq A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.2: Pepsin-like [50646] (10 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein Plasmepsin (a hemoglobin-degrading enzyme) [50673] (3 species)

7. Species Plasmodium vivax [TaxId:5855] [50675] (2 PDB entries)

8. Domain d1miqa_: 1miq A: [79151]

Details for d1miqa_

PDB Entry: 1miq, 2.5 Å

PDB Description: crystal structure of proplasmepsin from the human malarial pathogen plasmodium vivax

PDB Compounds: (A:) plasmepsin

SCOP Domain Sequences for d1miqa_:

Sequence; same for both SEQRES and ATOM records:

>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]}
hltlafkierpydkvlktiskknlknyiketfnffksgymkqnylgsendvielddvani
mfygegevgdnhqkfmlifdtgsanlwvpskkcnssgcsiknlydssksksyekdgtkvd
itygsgtvkgffskdlvtlghlsmpykfievtdtddlepiyssvefdgilglgwkdlsig
sidpivvelknqnkidnalftfylpvhdvhagyltiggieekfyegnityeklnhdlywq
idldvhfgkqtmekanvivdsgtttitapseflnkffanlnvikvpflpfyvttcdnkem
ptlefksanntytlepeyymnpilevddtlcmitmlpvdidsntfilgdpfmrkyftvfd
ydkesvgfaiakn

Timeline for d1miqa_:

• d1miqa_ first appeared in SCOP 1.63
  
• d1miqa_ appears in SCOP 1.71
  
• d1miqa_ appears in SCOP 1.75
  
• d1miqa_ appears in the current release, SCOPe 2.08