Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein T-cell antigen receptor [49125] (6 species) |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (10 PDB entries) |
Domain d1mi5e2: 1mi5 E:119-247 [79148] Other proteins in same PDB: d1mi5a1, d1mi5a2, d1mi5b_, d1mi5d1, d1mi5e1 LC13 clone |
PDB Entry: 1mi5 (more details), 2.5 Å
SCOP Domain Sequences for d1mi5e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mi5e2 b.1.1.2 (E:119-247) T-cell antigen receptor {Human (Homo sapiens), beta-chain} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgrad
Timeline for d1mi5e2: