![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (10 PDB entries) |
![]() | Domain d1mi5e1: 1mi5 E:3-118 [79147] Other proteins in same PDB: d1mi5a1, d1mi5a2, d1mi5b_, d1mi5d2, d1mi5e2 LC13 clone |
PDB Entry: 1mi5 (more details), 2.5 Å
SCOP Domain Sequences for d1mi5e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mi5e1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain} gvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksglps drffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvte
Timeline for d1mi5e1: