SCOP 1.63: Domain d1mi5e1: 1mi5 E:3-118

Lineage for d1mi5e1 (1mi5 E:3-118)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (10 PDB entries)

8. Domain d1mi5e1: 1mi5 E:3-118 [79147]
   Other proteins in same PDB: d1mi5a1, d1mi5a2, d1mi5b_, d1mi5d2, d1mi5e2
   LC13 clone

Details for d1mi5e1

PDB Entry: 1mi5, 2.5 Å

PDB Description: The crystal structure of LC13 TcR in complex with HLAB8-EBV peptide complex

SCOP Domain Sequences for d1mi5e1:

Sequence; same for both SEQRES and ATOM records:

>d1mi5e1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain}
gvsqsprykvakrgqdvalrcdpisghvslfwyqqalgqgpefltyfqneaqldksglps
drffaerpegsvstlkiqrtqqedsavylcasslgqayeqyfgpgtrltvte

Timeline for d1mi5e1:

• d1mi5e1 is new in SCOP 1.63
  
• d1mi5e1 appears in SCOP 1.65
  
• d1mi5e1 appears in the current release, SCOPe 2.08