SCOPe 2.03: Domain d1mi5d2: 1mi5 D:118-206

Lineage for d1mi5d2 (1mi5 D:118-206)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (7 species)
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (20 PDB entries)
Domain d1mi5d2: 1mi5 D:118-206 [79146]
Other proteins in same PDB: d1mi5a1, d1mi5a2, d1mi5b_, d1mi5d1, d1mi5e1
LC13 clone

Details for d1mi5d2

PDB Entry: 1mi5 (more details), 2.5 Å

PDB Description: The crystal structure of LC13 TcR in complex with HLAB8-EBV peptide complex

PDB Compounds: (D:) TcR alpha chain

SCOPe Domain Sequences for d1mi5d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mi5d2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d1mi5d2:

Click to download the PDB-style file with coordinates for d1mi5d2.
(The format of our PDB-style files is described here.)

Timeline for d1mi5d2: