Lineage for d1mi1b1 (1mi1 B:2249-2553)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014091Fold a.169: BEACH domain [81836] (1 superfamily)
    multihelical, complex architecture
  4. 2014092Superfamily a.169.1: BEACH domain [81837] (1 family) (S)
    automatically mapped to Pfam PF02138
  5. 2014093Family a.169.1.1: BEACH domain [81838] (2 protein domains)
    Pfam PF02138
  6. 2014094Protein BEACH domain of neurobeachin [81839] (1 species)
  7. 2014095Species Human (Homo sapiens) [TaxId:9606] [81840] (1 PDB entry)
  8. 2014097Domain d1mi1b1: 1mi1 B:2249-2553 [79139]
    Other proteins in same PDB: d1mi1a2, d1mi1b2

Details for d1mi1b1

PDB Entry: 1mi1 (more details), 2.9 Å

PDB Description: Crystal Structure of the PH-BEACH Domain of Human Neurobeachin
PDB Compounds: (B:) Neurobeachin

SCOPe Domain Sequences for d1mi1b1:

Sequence, based on SEQRES records: (download)

>d1mi1b1 a.169.1.1 (B:2249-2553) BEACH domain of neurobeachin {Human (Homo sapiens) [TaxId: 9606]}
vgtsyglpqarrislatprqlykssnmtqrwqrreisnfeylmflntiagrtyndlnqyp
vfpwvltnyeseeldltlpgnfrdlskpigalnpkravfyaeryetweddqsppyhynth
ystatstlswlvriepfttfflnandgkfdhpdrtfssvarswrtsqrdtsdvkelipef
yylpemfvnsngynlgvredevvvndvdlppwakkpedfvrinrmalesefvscqlhqwi
dlifgykqrgpeavralnvfhyltyegsvnldsitdpvlreameaqiqnfgqtpsqllie
phppr

Sequence, based on observed residues (ATOM records): (download)

>d1mi1b1 a.169.1.1 (B:2249-2553) BEACH domain of neurobeachin {Human (Homo sapiens) [TaxId: 9606]}
vgtsyglpqarrislatprqlykssnmtqrwqrreisnfeylmflntiagrtyndlnqyp
vfpwvltnyeseeldltlpgnfrdlskpigalnpkravfyaeryetweddqsppyhynth
ystatstlswlvriepfttfflnandgkfdhpdrtfssvarswrtsqrdtsdvkelipef
yylpemfvnsndvdlppwakkpedfvrinrmalesefvscqlhqwidlifgykqrgpeav
ralnvfhyltyegsvnldsitdpvlreameaqiqnfgqtpsqlliephppr

SCOPe Domain Coordinates for d1mi1b1:

Click to download the PDB-style file with coordinates for d1mi1b1.
(The format of our PDB-style files is described here.)

Timeline for d1mi1b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mi1b2