SCOPe 2.06: Domain d1mi0b1: 1mi0 B:5-62

Lineage for d1mi0b1 (1mi0 B:5-62)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (4 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (35 PDB entries)

8. Domain d1mi0b1: 1mi0 B:5-62 [79136]
   Other proteins in same PDB: d1mi0a2, d1mi0b2
   redesigned protein variant nuG2

Details for d1mi0b1

PDB Entry: 1mi0, 1.85 Å

PDB Description: crystal structure of the redesigned protein g variant nug2

PDB Compounds: (B:) immunoglobulin-binding protein G

SCOPe Domain Sequences for d1mi0b1:

Sequence; same for both SEQRES and ATOM records:

>d1mi0b1 d.15.7.1 (B:5-62) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
amdtyklvivlngttftytteavdaataekvfkqyandngvdgewtyadatktftvte

Timeline for d1mi0b1:

• d1mi0b1 first appeared in SCOP 1.63, called d1mi0b_
  
• d1mi0b1 was called d1mi0b_ in SCOPe 2.05
  
• d1mi0b1 appears in SCOPe 2.07
  
• d1mi0b1 appears in the current release, SCOPe 2.08