SCOPe 2.04: Domain d1mhxa_: 1mhx A:

Lineage for d1mhxa_ (1mhx A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin-binding protein G, different constituent domains [54360] (3 species)

7. Species Streptococcus sp., group G [TaxId:1306] [54361] (32 PDB entries)

8. Domain d1mhxa_: 1mhx A: [79134]
   redesigned protein variant nuG1

Details for d1mhxa_

PDB Entry: 1mhx, 1.8 Å

PDB Description: crystal structures of the redesigned protein g variant nug1

PDB Compounds: (A:) immunoglobulin-binding protein G

SCOPe Domain Sequences for d1mhxa_:

Sequence; same for both SEQRES and ATOM records:

>d1mhxa_ d.15.7.1 (A:) Immunoglobulin-binding protein G, different constituent domains {Streptococcus sp., group G [TaxId: 1306]}
mhhhhhhamdtyklfivigdrvvvvtteavdaataekvfkqyandngvdgewtyddaakt
ftvte

Timeline for d1mhxa_:

• d1mhxa_ first appeared in SCOP 1.63
  
• d1mhxa_ appears in SCOPe 2.03
  
• d1mhxa_ appears in SCOPe 2.05
  
• d1mhxa_ appears in the current release, SCOPe 2.08, called d1mhxa1