Lineage for d1mhw.2 (1mhw B:,D:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715176Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 715177Superfamily d.3.1: Cysteine proteinases [54001] (16 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 715178Family d.3.1.1: Papain-like [54002] (25 proteins)
  6. 715251Protein (Pro)cathepsin L [54026] (1 species)
  7. 715252Species Human (Homo sapiens) [TaxId:9606] [54027] (4 PDB entries)
  8. 715255Domain d1mhw.2: 1mhw B:,D: [79133]
    complexed with bp4, csw, dar, pea

Details for d1mhw.2

PDB Entry: 1mhw (more details), 1.9 Å

PDB Description: design of non-covalent inhibitors of human cathepsin l. from the 96- residue proregion to optimized tripeptides
PDB Compounds: (B:) Cathepsin L, (D:) Cathepsin L

SCOP Domain Sequences for d1mhw.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1mhw.2 d.3.1.1 (B:,D:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesXnkywl
vknswgeewgmggyvkmakdrrnhcgiasaasyptv

SCOP Domain Coordinates for d1mhw.2:

Click to download the PDB-style file with coordinates for d1mhw.2.
(The format of our PDB-style files is described here.)

Timeline for d1mhw.2: