SCOP 1.71: Domain d1mhw.1: 1mhw A:,C:

Lineage for d1mhw.1 (1mhw A:,C:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (12 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (23 proteins)

6. Protein (Pro)cathepsin L [54026] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54027] (4 PDB entries)

8. Domain d1mhw.1: 1mhw A:,C: [79132]

Details for d1mhw.1

PDB Entry: 1mhw, 1.9 Å

PDB Description: design of non-covalent inhibitors of human cathepsin l. from the 96- residue proregion to optimized tripeptides

SCOP Domain Sequences for d1mhw.1:

Sequence; same for both SEQRES and ATOM records:

>g1mhw.1 d.3.1.1 (A:,C:) (Pro)cathepsin L {Human (Homo sapiens)}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesXnkywl
vknswgeewgmggyvkmakdrrnhcgiasaasyptv

Timeline for d1mhw.1:

• d1mhw.1 first appeared in SCOP 1.63
  
• d1mhw.1 appears in SCOP 1.69
  
• d1mhw.1 appears in SCOP 1.73
  
• d1mhw.1 appears in the current release, SCOPe 2.08