Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein (Pro)cathepsin L [54026] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54027] (4 PDB entries) |
Domain d1mhw.1: 1mhw A:,C: [79132] |
PDB Entry: 1mhw (more details), 1.9 Å
SCOPe Domain Sequences for d1mhw.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1mhw.1 d.3.1.1 (A:,C:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfesXnkywl vknswgeewgmggyvkmakdrrnhcgiasaasyptv
Timeline for d1mhw.1:
View in 3D Domains from other chains: (mouse over for more information) d1mhw.2, d1mhw.2, d1mhw.2, d1mhw.2 |