SCOPe 2.07: Domain d1mhhf_: 1mhh F:

Lineage for d1mhhf_ (1mhh F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)

6. Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)

8. Domain d1mhhf_: 1mhh F: [79128]
   Other proteins in same PDB: d1mhha1, d1mhha2, d1mhhb1, d1mhhb2, d1mhhc1, d1mhhc2, d1mhhd1, d1mhhd2
   domain C
   complexed with edo

Details for d1mhhf_

PDB Entry: 1mhh, 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab

PDB Compounds: (F:) protein L domain C

SCOPe Domain Sequences for d1mhhf_:

Sequence; same for both SEQRES and ATOM records:

>d1mhhf_ d.15.7.1 (F:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngewtadledggnhmnikf
ag

Timeline for d1mhhf_:

• d1mhhf_ first appeared in SCOP 1.63
  
• d1mhhf_ appears in SCOPe 2.06
  
• d1mhhf_ appears in the current release, SCOPe 2.08