Lineage for d1mhhf_ (1mhh F:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407834Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 408437Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 408438Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)
  6. 408439Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 408440Species Peptostreptococcus magnus [TaxId:1260] [54363] (11 PDB entries)
  8. 408458Domain d1mhhf_: 1mhh F: [79128]
    Other proteins in same PDB: d1mhha1, d1mhha2, d1mhhb1, d1mhhb2, d1mhhc1, d1mhhc2, d1mhhd1, d1mhhd2
    domain C
    complexed with aea, edo; mutant

Details for d1mhhf_

PDB Entry: 1mhh (more details), 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab

SCOP Domain Sequences for d1mhhf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhhf_ d.15.7.1 (F:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngewtadledggnhmnikf
ag

SCOP Domain Coordinates for d1mhhf_:

Click to download the PDB-style file with coordinates for d1mhhf_.
(The format of our PDB-style files is described here.)

Timeline for d1mhhf_: