Lineage for d1mhhe_ (1mhh E:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894775Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 1894776Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 1894777Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)
  7. 1894778Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)
  8. 1894795Domain d1mhhe_: 1mhh E: [79127]
    Other proteins in same PDB: d1mhha1, d1mhha2, d1mhhb1, d1mhhb2, d1mhhc1, d1mhhc2, d1mhhd1, d1mhhd2
    domain C
    complexed with edo

Details for d1mhhe_

PDB Entry: 1mhh (more details), 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab
PDB Compounds: (E:) protein L domain C

SCOPe Domain Sequences for d1mhhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhhe_ d.15.7.1 (E:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngewtadledggnhmnikf
agk

SCOPe Domain Coordinates for d1mhhe_:

Click to download the PDB-style file with coordinates for d1mhhe_.
(The format of our PDB-style files is described here.)

Timeline for d1mhhe_: