SCOP 1.67: Domain d1mhhe_: 1mhh E:

Lineage for d1mhhe_ (1mhh E:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (11 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [54363] (11 PDB entries)

8. Domain d1mhhe_: 1mhh E: [79127]
   Other proteins in same PDB: d1mhha1, d1mhha2, d1mhhb1, d1mhhb2, d1mhhc1, d1mhhc2, d1mhhd1, d1mhhd2

Details for d1mhhe_

PDB Entry: 1mhh, 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab

SCOP Domain Sequences for d1mhhe_:

Sequence; same for both SEQRES and ATOM records:

>d1mhhe_ d.15.7.1 (E:) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus}
evtikvnlifadgkiqtaefkgtfeeataeayryaallakvngewtadledggnhmnikf
agk

Timeline for d1mhhe_:

• d1mhhe_ first appeared in SCOP 1.63
  
• d1mhhe_ appears in SCOP 1.65
  
• d1mhhe_ appears in SCOP 1.69
  
• d1mhhe_ appears in the current release, SCOPe 2.08