Lineage for d1mhhd2 (1mhh D:114-212)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453473Domain d1mhhd2: 1mhh D:114-212 [79126]
    Other proteins in same PDB: d1mhha1, d1mhha2, d1mhhb1, d1mhhc1, d1mhhc2, d1mhhd1, d1mhhe_, d1mhhf_
    part of anti-HCV Fab 19D9D6

Details for d1mhhd2

PDB Entry: 1mhh (more details), 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab

SCOP Domain Sequences for d1mhhd2:

Sequence, based on SEQRES records: (download)

>d1mhhd2 b.1.1.2 (D:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

Sequence, based on observed residues (ATOM records): (download)

>d1mhhd2 b.1.1.2 (D:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttppsvyplapgsansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlyt
lsssvtvpsstwpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d1mhhd2:

Click to download the PDB-style file with coordinates for d1mhhd2.
(The format of our PDB-style files is described here.)

Timeline for d1mhhd2: