SCOPe 2.02: Domain d1mhhd1: 1mhh D:1-113

Lineage for d1mhhd1 (1mhh D:1-113)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)
Uniprot P06327 20-117 # HV52_MOUSE (P06327) Ig heavy chain V region VH558 A1/A4 precursor; 57% sequence identity ! Uniprot P01631 # KV2G_MOUSE (P01631) Ig kappa chain V-II region 26-10

Domain d1mhhd1: 1mhh D:1-113 [79125]
Other proteins in same PDB: d1mhha1, d1mhha2, d1mhhb2, d1mhhc1, d1mhhc2, d1mhhd2, d1mhhe_, d1mhhf_
part of anti-HCV Fab 19D9D6
complexed with edo

Details for d1mhhd1

PDB Entry: 1mhh (more details), 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab

PDB Compounds: (D:) Fab, heavy chain

SCOPe Domain Sequences for d1mhhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhhd1 b.1.1.1 (D:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvss

SCOPe Domain Coordinates for d1mhhd1:

Click to download the PDB-style file with coordinates for d1mhhd1.
(The format of our PDB-style files is described here.)

Timeline for d1mhhd1: