Lineage for d1mhhd1 (1mhh D:1-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451404Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88554] (32 PDB entries)
  8. 451409Domain d1mhhd1: 1mhh D:1-113 [79125]
    Other proteins in same PDB: d1mhha1, d1mhha2, d1mhhb2, d1mhhc1, d1mhhc2, d1mhhd2, d1mhhe_, d1mhhf_
    part of anti-HCV Fab 19D9D6

Details for d1mhhd1

PDB Entry: 1mhh (more details), 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab

SCOP Domain Sequences for d1mhhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhhd1 b.1.1.1 (D:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4}
qiqlvqsgpelkkpgetvkisckasgytftdfsmhwvnqapgkglnwmgwvntetgepty
addfkgrfafsletsastaylqinslknedtatyfcarfllrqyfdvwgagttvtvss

SCOP Domain Coordinates for d1mhhd1:

Click to download the PDB-style file with coordinates for d1mhhd1.
(The format of our PDB-style files is described here.)

Timeline for d1mhhd1: