Lineage for d1mhhc1 (1mhh C:1-107)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 782637Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 783027Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (36 PDB entries)
  8. 783041Domain d1mhhc1: 1mhh C:1-107 [79123]
    Other proteins in same PDB: d1mhha2, d1mhhb1, d1mhhb2, d1mhhc2, d1mhhd1, d1mhhd2, d1mhhe_, d1mhhf_
    part of anti-HCV Fab 19D9D6
    complexed with aea, edo; mutant

Details for d1mhhc1

PDB Entry: 1mhh (more details), 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab
PDB Compounds: (C:) Fab, light chain

SCOP Domain Sequences for d1mhhc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhhc1 b.1.1.1 (C:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelk

SCOP Domain Coordinates for d1mhhc1:

Click to download the PDB-style file with coordinates for d1mhhc1.
(The format of our PDB-style files is described here.)

Timeline for d1mhhc1: