Lineage for d1mhha1 (1mhh A:1-107)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2353665Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2354061Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (51 PDB entries)
  8. 2354089Domain d1mhha1: 1mhh A:1-107 [79119]
    Other proteins in same PDB: d1mhha2, d1mhhb1, d1mhhb2, d1mhhc2, d1mhhd1, d1mhhd2, d1mhhe_, d1mhhf_
    part of anti-HCV Fab 19D9D6
    complexed with edo

Details for d1mhha1

PDB Entry: 1mhh (more details), 2.1 Å

PDB Description: structure of p. magnus protein l mutant bound to a mouse fab
PDB Compounds: (A:) Fab, light chain

SCOPe Domain Sequences for d1mhha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhha1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspkvliywastr
esgvpdrftgrgsgtdftltissvqaedqavyyckqayippltfgagtklelk

SCOPe Domain Coordinates for d1mhha1:

Click to download the PDB-style file with coordinates for d1mhha1.
(The format of our PDB-style files is described here.)

Timeline for d1mhha1: