Lineage for d1mh9a_ (1mh9 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 322675Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 322676Superfamily c.108.1: HAD-like [56784] (10 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 322766Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (1 protein)
    the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
  6. 322767Protein 5'(3')-deoxyribonucleotidase (dNT-2) [82383] (1 species)
  7. 322768Species Human (Homo sapiens) [TaxId:9606] [82384] (1 PDB entry)
  8. 322769Domain d1mh9a_: 1mh9 A: [79118]
    complexed with mg, po4

Details for d1mh9a_

PDB Entry: 1mh9 (more details), 1.8 Å

PDB Description: crystal structure analysis of deoxyribonucleotidase

SCOP Domain Sequences for d1mh9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mh9a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens)}
ralrvlvdmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs
waddwkaildskrp

SCOP Domain Coordinates for d1mh9a_:

Click to download the PDB-style file with coordinates for d1mh9a_.
(The format of our PDB-style files is described here.)

Timeline for d1mh9a_: