Lineage for d1mh6b_ (1mh6 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186669Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186670Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2186724Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2186725Protein Bleomycin resistance protein, BRP [54599] (3 species)
    Active as dimer
  7. 2186726Species Klebsiella pneumoniae [TaxId:573] [64256] (4 PDB entries)
    the transposon tn5-encoding bleomycin-binding protein, BlmT
  8. 2186738Domain d1mh6b_: 1mh6 B: [79117]

Details for d1mh6b_

PDB Entry: 1mh6 (more details)

PDB Description: solution structure of the transposon tn5-encoding bleomycin-binding protein, blmt
PDB Compounds: (B:) bleomycin resistance protein

SCOPe Domain Sequences for d1mh6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mh6b_ d.32.1.2 (B:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae [TaxId: 573]}
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqnel
lagis

SCOPe Domain Coordinates for d1mh6b_:

Click to download the PDB-style file with coordinates for d1mh6b_.
(The format of our PDB-style files is described here.)

Timeline for d1mh6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mh6a_