Lineage for d1mh6a_ (1mh6 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 255972Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 255973Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 256002Family d.32.1.2: Antibiotic resistance proteins [54598] (3 protein domains)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 256003Protein Bleomycin resistance protein, BRP [54599] (3 species)
    Active as dimer
  7. 256004Species Klebsiella pneumoniae [TaxId:573] [64256] (3 PDB entries)
    the transposon tn5-encoding bleomycin-binding protein, BlmT
  8. 256015Domain d1mh6a_: 1mh6 A: [79116]

Details for d1mh6a_

PDB Entry: 1mh6 (more details)

PDB Description: Solution Structure of the Transposon Tn5-encoding Bleomycin-binding Protein, BLMT

SCOP Domain Sequences for d1mh6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mh6a_ d.32.1.2 (A:) Bleomycin resistance protein, BRP {Klebsiella pneumoniae}
tdqatpnlpsrdfdstaafyerlgfgivfrdagwmilqrgdlmleffahpgldplaswfs
cclrlddlaefyrqcksvgiqetssgyprihapelqewggtmaalvdpdgtllrliqnel
lagis

SCOP Domain Coordinates for d1mh6a_:

Click to download the PDB-style file with coordinates for d1mh6a_.
(The format of our PDB-style files is described here.)

Timeline for d1mh6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mh6b_