Lineage for d1mh4a1 (1mh4 A:472-523)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1720412Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 1720526Protein Mating type protein A1 Homeodomain [46693] (1 species)
  7. 1720527Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46694] (6 PDB entries)
  8. 1720533Domain d1mh4a1: 1mh4 A:472-523 [79114]
    Other proteins in same PDB: d1mh4a2
    chimera with maltose-binding protein

Details for d1mh4a1

PDB Entry: 1mh4 (more details), 2.3 Å

PDB Description: maltose binding-a1 homeodomain protein chimera, crystal form ii
PDB Compounds: (A:) maltose binding-a1 homeodomain protein chimera

SCOPe Domain Sequences for d1mh4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mh4a1 a.4.1.1 (A:472-523) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aaaaaispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrm

SCOPe Domain Coordinates for d1mh4a1:

Click to download the PDB-style file with coordinates for d1mh4a1.
(The format of our PDB-style files is described here.)

Timeline for d1mh4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mh4a2