| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
| Protein Mating type protein A1 Homeodomain [46693] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46694] (6 PDB entries) |
| Domain d1mh4a1: 1mh4 A:472-523 [79114] Other proteins in same PDB: d1mh4a2 chimera with maltose-binding protein |
PDB Entry: 1mh4 (more details), 2.3 Å
SCOPe Domain Sequences for d1mh4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mh4a1 a.4.1.1 (A:472-523) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aaaaaispqarafleqvfrrkqslnskekeevakkcgitplqvrvwfinkrm
Timeline for d1mh4a1: